![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins) automatically mapped to Pfam PF02668 |
![]() | Protein Putative alkylsulfatase AtsK [101989] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries) Uniprot Q9WWU5 |
![]() | Domain d1vz5b_: 1vz5 B: [114037] complexed with sin |
PDB Entry: 1vz5 (more details), 2.15 Å
SCOPe Domain Sequences for d1vz5b_:
Sequence, based on SEQRES records: (download)
>d1vz5b_ b.82.2.5 (B:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]} leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
>d1vz5b_ b.82.2.5 (B:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]} leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa kllgepvapvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwanta aayqelpeplreladklwavhsnevyetehpvvrvhpisgeralqlghfvkrikgyslad sqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagev pvgvdgqlsrttrk
Timeline for d1vz5b_: