Lineage for d1vz4d_ (1vz4 D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
    automatically mapped to Pfam PF02668
  6. Protein Putative alkylsulfatase AtsK [101989] (1 species)
  7. Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries)
    Uniprot Q9WWU5
  8. Domain d1vz4d_: 1vz4 D: [114035]
    complexed with fe2, sin

Details for d1vz4d_

PDB Entry: 1vz4 (more details), 2.5 Å

PDB Description: fe-succinate complex of atsk
PDB Compounds: (D:) putative alkylsulfatase atsk

SCOPe Domain Sequences for d1vz4d_:

Sequence, based on SEQRES records: (download)

>d1vz4d_ b.82.2.5 (D:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg
gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy
etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag
dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk

Sequence, based on observed residues (ATOM records): (download)

>d1vz4d_ b.82.2.5 (D:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahpvvdgtryllqldgranswhtdvtfveaypkasilrsvvapasggdtvwan
taaayqelpeplreladklwavhsneydyayetehpvvrvhpisgeralqlghfvkrikg
ysladsqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvt
lagevpvgvdgqlsrttrk

SCOPe Domain Coordinates for d1vz4d_ are not available.

Timeline for d1vz4d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vz4a_