Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.293: Phosphoprotein M1, C-terminal domain [118172] (1 superfamily) consists of 6 helices and one beta-hairpin |
Superfamily d.293.1: Phosphoprotein M1, C-terminal domain [118173] (2 families) automatically mapped to Pfam PF03012 |
Family d.293.1.1: Phosphoprotein M1, C-terminal domain [118174] (2 proteins) C-terminal part of Pfam PF03012 |
Protein Phosphoprotein M1, C-terminal domain [118175] (1 species) |
Species Rabies virus, strain CVS-11 [TaxId:11292] [118176] (1 PDB entry) Uniprot P22363 186-296 |
Domain d1vyia_: 1vyi A: [114032] complexed with gol |
PDB Entry: 1vyi (more details), 1.5 Å
SCOPe Domain Sequences for d1vyia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyia_ d.293.1.1 (A:) Phosphoprotein M1, C-terminal domain {Rabies virus, strain CVS-11 [TaxId: 11292]} wsatneeddlsveaeiahqiaesfskkykfpsrssgiflynfeqlkmnlddivkeaknvp gvtrlahdgskiplrcvlgwvalanskkfqllveadklskimqddlnryts
Timeline for d1vyia_: