![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Flavin-dependent monoxygenase SPBP16F5.08c [117444] (1 species) |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [117445] (1 PDB entry) |
![]() | Domain d1vqwb2: 1vqw B:181-287 [114031] complexed with epe, fad Structural genomics target |
PDB Entry: 1vqw (more details), 2.4 Å
SCOP Domain Sequences for d1vqwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqwb2 c.3.1.5 (B:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe} ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc
Timeline for d1vqwb2: