Lineage for d1vqwb2 (1vqw B:181-287)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576622Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 576680Protein Flavin-dependent monoxygenase SPBP16F5.08c [117444] (1 species)
  7. 576681Species Schizosaccharomyces pombe [TaxId:284812] [117445] (1 PDB entry)
  8. 576685Domain d1vqwb2: 1vqw B:181-287 [114031]
    complexed with epe, fad
    Structural genomics target

Details for d1vqwb2

PDB Entry: 1vqw (more details), 2.4 Å

PDB Description: crystal structure of a protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases

SCOP Domain Sequences for d1vqwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqwb2 c.3.1.5 (B:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe}
ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc

SCOP Domain Coordinates for d1vqwb2:

Click to download the PDB-style file with coordinates for d1vqwb2.
(The format of our PDB-style files is described here.)

Timeline for d1vqwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqwb1