Lineage for d1vqwb1 (1vqw B:3-180,B:288-444)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849963Protein Flavin-dependent monoxygenase SPBP16F5.08c, N- and C-terminal domain [418940] (1 species)
  7. 2849964Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [419392] (3 PDB entries)
    Uniprot Q9HFE4
  8. 2849972Domain d1vqwb1: 1vqw B:3-180,B:288-444 [114030]
    Other proteins in same PDB: d1vqwa2, d1vqwb2
    Structural genomics target
    complexed with epe, fad

    has additional insertions and/or extensions that are not grouped together

Details for d1vqwb1

PDB Entry: 1vqw (more details), 2.4 Å

PDB Description: crystal structure of a protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases
PDB Compounds: (B:) protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases

SCOPe Domain Sequences for d1vqwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqwb1 c.3.1.5 (B:3-180,B:288-444) Flavin-dependent monoxygenase SPBP16F5.08c, N- and C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyXt
gylysvpfpslaklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqa
qaaflarvwsgrlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckq
atpvleeefpspywgekersirenmwsirakffgie

SCOPe Domain Coordinates for d1vqwb1:

Click to download the PDB-style file with coordinates for d1vqwb1.
(The format of our PDB-style files is described here.)

Timeline for d1vqwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqwb2