Lineage for d1vqvb2 (1vqv B:138-300)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734160Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 734161Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 734162Family d.139.1.1: PurM C-terminal domain-like [56043] (4 proteins)
  6. 734187Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 734188Species Aquifex aeolicus [TaxId:63363] [118112] (1 PDB entry)
  8. 734190Domain d1vqvb2: 1vqv B:138-300 [114027]
    Other proteins in same PDB: d1vqva1, d1vqvb1
    structural genomics target
    complexed with po4

Details for d1vqvb2

PDB Entry: 1vqv (more details), 2.65 Å

PDB Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOP Domain Sequences for d1vqvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqvb2 d.139.1.1 (B:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

SCOP Domain Coordinates for d1vqvb2:

Click to download the PDB-style file with coordinates for d1vqvb2.
(The format of our PDB-style files is described here.)

Timeline for d1vqvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqvb1