Lineage for d1vqvb1 (1vqv B:1-137)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421161Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1421162Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1421218Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species)
  7. 1421219Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries)
    Uniprot O67883
  8. 1421229Domain d1vqvb1: 1vqv B:1-137 [114026]
    Other proteins in same PDB: d1vqva2, d1vqvb2
    Structural genomics target
    complexed with po4

Details for d1vqvb1

PDB Entry: 1vqv (more details), 2.65 Å

PDB Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1vqvb1:

Sequence, based on SEQRES records: (download)

>d1vqvb1 d.79.4.1 (B:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete

Sequence, based on observed residues (ATOM records): (download)

>d1vqvb1 d.79.4.1 (B:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelgefglidlikktleskviddtapveklllttdvlnegvhflrsyipeavgwkai
svnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksek
igisvflvgete

SCOPe Domain Coordinates for d1vqvb1:

Click to download the PDB-style file with coordinates for d1vqvb1.
(The format of our PDB-style files is described here.)

Timeline for d1vqvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqvb2