Lineage for d1vqva2 (1vqv A:138-300)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734160Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 734161Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 734162Family d.139.1.1: PurM C-terminal domain-like [56043] (4 proteins)
  6. 734187Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species)
  7. 734188Species Aquifex aeolicus [TaxId:63363] [118112] (1 PDB entry)
  8. 734189Domain d1vqva2: 1vqv A:138-300 [114025]
    Other proteins in same PDB: d1vqva1, d1vqvb1

Details for d1vqva2

PDB Entry: 1vqv (more details), 2.65 Å

PDB Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOP Domain Sequences for d1vqva2:

Sequence, based on SEQRES records: (download)

>d1vqva2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1vqva2 d.139.1.1 (A:138-300) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveeggvfvdgkkvep

SCOP Domain Coordinates for d1vqva2:

Click to download the PDB-style file with coordinates for d1vqva2.
(The format of our PDB-style files is described here.)

Timeline for d1vqva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqva1