Lineage for d1vqva1 (1vqv A:1-137)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727583Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 727584Family d.79.4.1: PurM N-terminal domain-like [55327] (4 proteins)
  6. 727609Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species)
  7. 727610Species Aquifex aeolicus [TaxId:63363] [118031] (1 PDB entry)
  8. 727611Domain d1vqva1: 1vqv A:1-137 [114024]
    Other proteins in same PDB: d1vqva2, d1vqvb2

Details for d1vqva1

PDB Entry: 1vqv (more details), 2.65 Å

PDB Description: crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOP Domain Sequences for d1vqva1:

Sequence, based on SEQRES records: (download)

>d1vqva1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete

Sequence, based on observed residues (ATOM records): (download)

>d1vqva1 d.79.4.1 (A:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mrlkelglidlikktleskviddtapvskklllttdvlnegvhflrsyipeavgwkaisv
nvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksekig
isvflvgete

SCOP Domain Coordinates for d1vqva1:

Click to download the PDB-style file with coordinates for d1vqva1.
(The format of our PDB-style files is described here.)

Timeline for d1vqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqva2