SCOP 1.71: Domain d1vqse_: 1vqs E:

Lineage for d1vqse_ (1vqs E:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.13: NIPSNAP [117943] (1 protein)
   Pfam 07978

6. Protein Hypothetical protein Atu4242 [117944] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [117945] (1 PDB entry)

8. Domain d1vqse_: 1vqs E: [114023]
   structural genomics target
   complexed with mpd, so4

Details for d1vqse_

PDB Entry: 1vqs, 1.5 Å

PDB Description: Crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 A resolution

SCOP Domain Sequences for d1vqse_:

Sequence; same for both SEQRES and ATOM records:

>d1vqse_ d.58.4.13 (E:) Hypothetical protein Atu4242 {Agrobacterium tumefaciens}
hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi
wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm

Timeline for d1vqse_:

• d1vqse_ is new in SCOP 1.71
  
• d1vqse_ appears in SCOP 1.73
  
• d1vqse_ appears in the current release, SCOPe 2.08, called d1vqse1