Lineage for d1vqsd_ (1vqs D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603552Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 603687Family d.58.4.13: NIPSNAP [117943] (1 protein)
    Pfam 07978
  6. 603688Protein Hypothetical protein Atu4242 [117944] (1 species)
  7. 603689Species Agrobacterium tumefaciens [TaxId:358] [117945] (1 PDB entry)
  8. 603693Domain d1vqsd_: 1vqs D: [114022]

Details for d1vqsd_

PDB Entry: 1vqs (more details), 1.5 Å

PDB Description: Crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 A resolution

SCOP Domain Sequences for d1vqsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqsd_ d.58.4.13 (D:) Hypothetical protein Atu4242 {Agrobacterium tumefaciens}
hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi
wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm

SCOP Domain Coordinates for d1vqsd_:

Click to download the PDB-style file with coordinates for d1vqsd_.
(The format of our PDB-style files is described here.)

Timeline for d1vqsd_: