Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.13: NIPSNAP [117943] (1 protein) Pfam 07978 |
Protein Hypothetical protein Atu4242 [117944] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [117945] (1 PDB entry) |
Domain d1vqsd_: 1vqs D: [114022] |
PDB Entry: 1vqs (more details), 1.5 Å
SCOP Domain Sequences for d1vqsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqsd_ d.58.4.13 (D:) Hypothetical protein Atu4242 {Agrobacterium tumefaciens} hhhhhhmfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhi wafsslddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
Timeline for d1vqsd_:
View in 3D Domains from other chains: (mouse over for more information) d1vqsa_, d1vqsb_, d1vqsc_, d1vqse_ |