Lineage for d1vqsd1 (1vqs D:1-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949951Family d.58.4.13: NIPSNAP [117943] (2 proteins)
    Pfam PF07978
  6. 2949952Protein Hypothetical protein Atu4242 [117944] (1 species)
  7. 2949953Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries)
    Uniprot Q8U857
  8. 2949957Domain d1vqsd1: 1vqs D:1-104 [114022]
    Other proteins in same PDB: d1vqsa2, d1vqsb2, d1vqsc2, d1vqsd2, d1vqse2
    structural genomics target
    complexed with mpd, so4

Details for d1vqsd1

PDB Entry: 1vqs (more details), 1.5 Å

PDB Description: Crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 A resolution
PDB Compounds: (D:) hypothetical protein AGR_L_1239

SCOPe Domain Sequences for d1vqsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqsd1 d.58.4.13 (D:1-104) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]}
mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm

SCOPe Domain Coordinates for d1vqsd1:

Click to download the PDB-style file with coordinates for d1vqsd1.
(The format of our PDB-style files is described here.)

Timeline for d1vqsd1: