Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.13: NIPSNAP [117943] (2 proteins) Pfam PF07978 |
Protein Hypothetical protein Atu4242 [117944] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries) Uniprot Q8U857 |
Domain d1vqsd1: 1vqs D:1-104 [114022] Other proteins in same PDB: d1vqsa2, d1vqsb2, d1vqsc2, d1vqsd2, d1vqse2 structural genomics target complexed with mpd, so4 |
PDB Entry: 1vqs (more details), 1.5 Å
SCOPe Domain Sequences for d1vqsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqsd1 d.58.4.13 (D:1-104) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]} mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
Timeline for d1vqsd1: