SCOPe 2.08: Domain d1vqsc1: 1vqs C:1-104

Lineage for d1vqsc1 (1vqs C:1-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.13: NIPSNAP [117943] (2 proteins)
   Pfam PF07978

6. Protein Hypothetical protein Atu4242 [117944] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries)
   Uniprot Q8U857

8. Domain d1vqsc1: 1vqs C:1-104 [114021]
   Other proteins in same PDB: d1vqsa2, d1vqsb2, d1vqsc2, d1vqsd2, d1vqse2
   structural genomics target
   complexed with mpd, so4

Details for d1vqsc1

PDB Entry: 1vqs, 1.5 Å

PDB Description: Crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 A resolution

PDB Compounds: (C:) hypothetical protein AGR_L_1239

SCOPe Domain Sequences for d1vqsc1:

Sequence; same for both SEQRES and ATOM records:

>d1vqsc1 d.58.4.13 (C:1-104) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]}
mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm

Timeline for d1vqsc1:

• d1vqsc1 first appeared in SCOP 1.71, called d1vqsc_
  
• d1vqsc1 appears in SCOPe 2.07