![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.13: NIPSNAP [117943] (2 proteins) Pfam PF07978 |
![]() | Protein Hypothetical protein Atu4242 [117944] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [117945] (2 PDB entries) Uniprot Q8U857 |
![]() | Domain d1vqsb1: 1vqs B:1-104 [114020] Other proteins in same PDB: d1vqsa2, d1vqsb2, d1vqsc2, d1vqsd2, d1vqse2 structural genomics target complexed with mpd, so4 |
PDB Entry: 1vqs (more details), 1.5 Å
SCOPe Domain Sequences for d1vqsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqsb1 d.58.4.13 (B:1-104) Hypothetical protein Atu4242 {Agrobacterium tumefaciens [TaxId: 358]} mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
Timeline for d1vqsb1: