Lineage for d1vqrc_ (1vqr C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350156Family a.211.1.3: modified HD domain [116973] (1 protein)
    retains the superfamily core fold but lacks the conserved metal-binding site
  6. 2350157Protein Hypothetical protein Cj0248 [116974] (1 species)
  7. 2350158Species Campylobacter jejuni [TaxId:197] [116975] (1 PDB entry)
    Uniprot Q9PIP7
  8. 2350161Domain d1vqrc_: 1vqr C: [114017]
    Other proteins in same PDB: d1vqra2
    Structural genomics target

Details for d1vqrc_

PDB Entry: 1vqr (more details), 2.25 Å

PDB Description: crystal structure of a virulence factor (cj0248) from campylobacter jejuni subsp. jejuni at 2.25 a resolution
PDB Compounds: (C:) hypothetical protein Cj0248

SCOPe Domain Sequences for d1vqrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqrc_ a.211.1.3 (C:) Hypothetical protein Cj0248 {Campylobacter jejuni [TaxId: 197]}
migdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiissdplmtakllqla
nspyygftreittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcnee
atfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalae
neflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphd
gsspfnakaavallkeaktqginfdlnnllsklpnkakenl

SCOPe Domain Coordinates for d1vqrc_:

Click to download the PDB-style file with coordinates for d1vqrc_.
(The format of our PDB-style files is described here.)

Timeline for d1vqrc_: