![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.3: modified HD domain [116973] (1 protein) retains the superfamily core fold but lacks the conserved metal-binding site |
![]() | Protein Hypothetical protein Cj0248 [116974] (1 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [116975] (1 PDB entry) Uniprot Q9PIP7 |
![]() | Domain d1vqrc_: 1vqr C: [114017] Other proteins in same PDB: d1vqra2 Structural genomics target |
PDB Entry: 1vqr (more details), 2.25 Å
SCOPe Domain Sequences for d1vqrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqrc_ a.211.1.3 (C:) Hypothetical protein Cj0248 {Campylobacter jejuni [TaxId: 197]} migdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiissdplmtakllqla nspyygftreittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcnee atfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalae neflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphd gsspfnakaavallkeaktqginfdlnnllsklpnkakenl
Timeline for d1vqrc_:
![]() Domains from other chains: (mouse over for more information) d1vqra1, d1vqra2, d1vqrb_, d1vqrd_ |