Lineage for d1vqra_ (1vqr A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753691Family a.211.1.3: modified HD domain [116973] (1 protein)
    retains the superfamily core fold but lacks the conserved metal-binding site
  6. 1753692Protein Hypothetical protein Cj0248 [116974] (1 species)
  7. 1753693Species Campylobacter jejuni [TaxId:197] [116975] (1 PDB entry)
    Uniprot Q9PIP7
  8. 1753694Domain d1vqra_: 1vqr A: [114015]
    Structural genomics target

Details for d1vqra_

PDB Entry: 1vqr (more details), 2.25 Å

PDB Description: crystal structure of a virulence factor (cj0248) from campylobacter jejuni subsp. jejuni at 2.25 a resolution
PDB Compounds: (A:) hypothetical protein Cj0248

SCOPe Domain Sequences for d1vqra_:

Sequence, based on SEQRES records: (download)

>d1vqra_ a.211.1.3 (A:) Hypothetical protein Cj0248 {Campylobacter jejuni [TaxId: 197]}
hmigdmnelllksvevlpplpdtvsklrkyvseansnietmkvaeiissdplmtakllql
anspyygftreittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcne
eatfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlala
eneflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaph
dgsspfnakaavallkeaktqginfdlnnllsklpnkakenlnked

Sequence, based on observed residues (ATOM records): (download)

>d1vqra_ a.211.1.3 (A:) Hypothetical protein Cj0248 {Campylobacter jejuni [TaxId: 197]}
hmigdmnelllksvevlpplpdtvsklrkyvseanietmkvaeiissdplmtakllqlan
spyygftreittinqvitllgvgniinivmadsirdnfkidvspyglntqnflktcneea
tfianwlndedkklshllvpcamllrlgivifsnfliqnhkdkdflaflnknenlalaen
eflgvdhisflgfllhrwnfddvliesicfvrtphaarekvkksayalaitdhlfaphdg
sspfnakaavallkeaktqginfdlnnllsklpnkakenlnked

SCOPe Domain Coordinates for d1vqra_:

Click to download the PDB-style file with coordinates for d1vqra_.
(The format of our PDB-style files is described here.)

Timeline for d1vqra_: