Lineage for d1vqqb3 (1vqq B:328-668)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244877Protein Penicillin binding protein 2a (PBP2A), C-terminal domain [82838] (1 species)
  7. 2244878Species Staphylococcus aureus [TaxId:1280] [82839] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2244880Domain d1vqqb3: 1vqq B:328-668 [114014]
    Other proteins in same PDB: d1vqqa1, d1vqqa2, d1vqqb1, d1vqqb2
    complexed with cd, cl

Details for d1vqqb3

PDB Entry: 1vqq (more details), 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.
PDB Compounds: (B:) penicillin-binding protein mecA, low-affinity

SCOPe Domain Sequences for d1vqqb3:

Sequence, based on SEQRES records: (download)

>d1vqqb3 e.3.1.1 (B:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d1vqqb3 e.3.1.1 (B:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqildne
illadsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiskeninll
tdgmqqvvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmainvkdvq
dkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d1vqqb3:

Click to download the PDB-style file with coordinates for d1vqqb3.
(The format of our PDB-style files is described here.)

Timeline for d1vqqb3: