SCOPe 2.03: Domain d1vqqb1: 1vqq B:27-138

Lineage for d1vqqb1 (1vqq B:27-138)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
   some sequence similarity to KSI
   automatically mapped to Pfam PF05223

6. Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries)
   Uniprot O54286 27-668

8. Domain d1vqqb1: 1vqq B:27-138 [114012]
   Other proteins in same PDB: d1vqqa2, d1vqqa3, d1vqqb2, d1vqqb3
   complexed with cd, cl

Details for d1vqqb1

PDB Entry: 1vqq, 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.

PDB Compounds: (B:) penicillin-binding protein mecA, low-affinity

SCOPe Domain Sequences for d1vqqb1:

Sequence, based on SEQRES records:

>d1vqqb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Sequence, based on observed residues (ATOM records):

>d1vqqb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
krvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d1vqqb1:

• d1vqqb1 first appeared in SCOP 1.71
  
• d1vqqb1 appears in SCOPe 2.02
  
• d1vqqb1 appears in SCOPe 2.04
  
• d1vqqb1 appears in the current release, SCOPe 2.08