Lineage for d1vqqb1 (1vqq B:27-138)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718985Superfamily d.17.4: NTF2-like [54427] (13 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 719171Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
  6. 719172Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 719173Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries)
  8. 719175Domain d1vqqb1: 1vqq B:27-138 [114012]
    Other proteins in same PDB: d1vqqa2, d1vqqa3, d1vqqb2, d1vqqb3
    complexed with cd, cl; mutant

Details for d1vqqb1

PDB Entry: 1vqq (more details), 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.
PDB Compounds: (B:) penicillin-binding protein mecA, low-affinity

SCOP Domain Sequences for d1vqqb1:

Sequence, based on SEQRES records: (download)

>d1vqqb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Sequence, based on observed residues (ATOM records): (download)

>d1vqqb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
krvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOP Domain Coordinates for d1vqqb1:

Click to download the PDB-style file with coordinates for d1vqqb1.
(The format of our PDB-style files is described here.)

Timeline for d1vqqb1: