Lineage for d1vqqa2 (1vqq A:139-327)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237129Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2237130Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2237131Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 2237132Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 2237133Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2237134Domain d1vqqa2: 1vqq A:139-327 [114010]
    Other proteins in same PDB: d1vqqa1, d1vqqa3, d1vqqb1, d1vqqb3
    complexed with cd, cl

Details for d1vqqa2

PDB Entry: 1vqq (more details), 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.
PDB Compounds: (A:) penicillin-binding protein mecA, low-affinity

SCOPe Domain Sequences for d1vqqa2:

Sequence, based on SEQRES records: (download)

>d1vqqa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Sequence, based on observed residues (ATOM records): (download)

>d1vqqa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk
dgkdiqlt

SCOPe Domain Coordinates for d1vqqa2:

Click to download the PDB-style file with coordinates for d1vqqa2.
(The format of our PDB-style files is described here.)

Timeline for d1vqqa2: