SCOPe 2.04: Domain d1vqqa2: 1vqq A:139-327

Lineage for d1vqqa2 (1vqq A:139-327)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (6 PDB entries)
   Uniprot O54286 27-668

8. Domain d1vqqa2: 1vqq A:139-327 [114010]
   Other proteins in same PDB: d1vqqa1, d1vqqa3, d1vqqb1, d1vqqb3
   complexed with cd, cl

Details for d1vqqa2

PDB Entry: 1vqq, 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.

PDB Compounds: (A:) penicillin-binding protein mecA, low-affinity

SCOPe Domain Sequences for d1vqqa2:

Sequence, based on SEQRES records:

>d1vqqa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Sequence, based on observed residues (ATOM records):

>d1vqqa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk
dgkdiqlt

Timeline for d1vqqa2:

• d1vqqa2 first appeared in SCOP 1.71
  
• d1vqqa2 appears in SCOPe 2.03
  
• d1vqqa2 appears in SCOPe 2.05
  
• d1vqqa2 appears in the current release, SCOPe 2.08