SCOP 1.71: Domain d1vqqa2: 1vqq A:139-327

Lineage for d1vqqa2 (1vqq A:139-327)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family)

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries)

8. Domain d1vqqa2: 1vqq A:139-327 [114010]
   Other proteins in same PDB: d1vqqa1, d1vqqa3, d1vqqb1, d1vqqb3

Details for d1vqqa2

PDB Entry: 1vqq, 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.

SCOP Domain Sequences for d1vqqa2:

Sequence, based on SEQRES records:

>d1vqqa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Sequence, based on observed residues (ATOM records):

>d1vqqa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk
dgkdiqlt

Timeline for d1vqqa2:

• d1vqqa2 is new in SCOP 1.71
  
• d1vqqa2 appears in SCOP 1.73
  
• d1vqqa2 appears in the current release, SCOPe 2.08