| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI automatically mapped to Pfam PF05223 |
| Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries) Uniprot O54286 27-668 |
| Domain d1vqqa1: 1vqq A:27-138 [114009] Other proteins in same PDB: d1vqqa2, d1vqqa3, d1vqqb2, d1vqqb3 complexed with cd, cl |
PDB Entry: 1vqq (more details), 1.8 Å
SCOPe Domain Sequences for d1vqqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqqa1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d1vqqa1: