Lineage for d1vq3d1 (1vq3 D:1-82)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2241805Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2241806Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 2241807Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
    automatically mapped to Pfam PF02700
  6. 2241808Protein PurS subunit of FGAM synthetase [82699] (3 species)
  7. 2241819Species Thermotoga maritima [TaxId:2336] [117995] (1 PDB entry)
    Uniprot Q9X0X1
  8. 2241823Domain d1vq3d1: 1vq3 D:1-82 [114008]
    Other proteins in same PDB: d1vq3a2, d1vq3b2, d1vq3c2, d1vq3d2
    Structural genomics target

Details for d1vq3d1

PDB Entry: 1vq3 (more details), 1.9 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3) (TM1244) from Thermotoga maritima at 1.90 A resolution
PDB Compounds: (D:) Phosphoribosylformylglycinamidine synthase, purS subunit

SCOPe Domain Sequences for d1vq3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq3d1 d.284.1.1 (D:1-82) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]}
lplfkfaidvqyrsnvrdprgetiervlreekglpvkklrlgksihleveaenkekayei
vkkaceellvnpvveeyevrel

SCOPe Domain Coordinates for d1vq3d1:

Click to download the PDB-style file with coordinates for d1vq3d1.
(The format of our PDB-style files is described here.)

Timeline for d1vq3d1: