Lineage for d1vq3d_ (1vq3 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688280Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1688281Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 1688282Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
    automatically mapped to Pfam PF02700
  6. 1688283Protein PurS subunit of FGAM synthetase [82699] (3 species)
  7. 1688294Species Thermotoga maritima [TaxId:2336] [117995] (1 PDB entry)
    Uniprot Q9X0X1
  8. 1688298Domain d1vq3d_: 1vq3 D: [114008]
    Structural genomics target

Details for d1vq3d_

PDB Entry: 1vq3 (more details), 1.9 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3) (TM1244) from Thermotoga maritima at 1.90 A resolution
PDB Compounds: (D:) Phosphoribosylformylglycinamidine synthase, purS subunit

SCOPe Domain Sequences for d1vq3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq3d_ d.284.1.1 (D:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]}
hhlplfkfaidvqyrsnvrdprgetiervlreekglpvkklrlgksihleveaenkekay
eivkkaceellvnpvveeyevrel

SCOPe Domain Coordinates for d1vq3d_:

Click to download the PDB-style file with coordinates for d1vq3d_.
(The format of our PDB-style files is described here.)

Timeline for d1vq3d_: