Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.284.1: PurS-like [82697] (3 families) segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein) automatically mapped to Pfam PF02700 |
Protein PurS subunit of FGAM synthetase [82699] (3 species) |
Species Thermotoga maritima [TaxId:2336] [117995] (1 PDB entry) Uniprot Q9X0X1 |
Domain d1vq3d_: 1vq3 D: [114008] Structural genomics target |
PDB Entry: 1vq3 (more details), 1.9 Å
SCOPe Domain Sequences for d1vq3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq3d_ d.284.1.1 (D:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]} hhlplfkfaidvqyrsnvrdprgetiervlreekglpvkklrlgksihleveaenkekay eivkkaceellvnpvveeyevrel
Timeline for d1vq3d_: