Lineage for d1vq3b_ (1vq3 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617225Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 617226Superfamily d.284.1: PurS-like [82697] (2 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 617227Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
  6. 617228Protein PurS subunit of FGAM synthetase [82699] (3 species)
  7. 617239Species Thermotoga maritima [TaxId:243274] [117995] (1 PDB entry)
  8. 617241Domain d1vq3b_: 1vq3 B: [114006]

Details for d1vq3b_

PDB Entry: 1vq3 (more details), 1.9 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3) (TM1244) from Thermotoga maritima at 1.90 A resolution

SCOP Domain Sequences for d1vq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq3b_ d.284.1.1 (B:) PurS subunit of FGAM synthetase {Thermotoga maritima}
hhlplfkfaidvqyrsnvrdprgetiervlreekglpvkklrlgksihleveaenkekay
eivkkaceellvnpvveeyevrel

SCOP Domain Coordinates for d1vq3b_:

Click to download the PDB-style file with coordinates for d1vq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1vq3b_: