SCOPe 2.08: Domain d1vq3b1: 1vq3 B:1-82

Lineage for d1vq3b1 (1vq3 B:1-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (3 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)
   automatically mapped to Pfam PF02700

6. Protein PurS subunit of FGAM synthetase [82699] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [117995] (1 PDB entry)
   Uniprot Q9X0X1

8. Domain d1vq3b1: 1vq3 B:1-82 [114006]
   Other proteins in same PDB: d1vq3a2, d1vq3b2, d1vq3c2, d1vq3d2
   Structural genomics target

Details for d1vq3b1

PDB Entry: 1vq3, 1.9 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3) (TM1244) from Thermotoga maritima at 1.90 A resolution

PDB Compounds: (B:) Phosphoribosylformylglycinamidine synthase, purS subunit

SCOPe Domain Sequences for d1vq3b1:

Sequence; same for both SEQRES and ATOM records:

>d1vq3b1 d.284.1.1 (B:1-82) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]}
lplfkfaidvqyrsnvrdprgetiervlreekglpvkklrlgksihleveaenkekayei
vkkaceellvnpvveeyevrel

Timeline for d1vq3b1:

• d1vq3b1 first appeared in SCOP 1.71, called d1vq3b_
  
• d1vq3b1 appears in SCOPe 2.07