Lineage for d1vq2a_ (1vq2 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594389Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 594390Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 594422Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (3 proteins)
    strand 5 is parallel to strand 4
  6. 594433Protein Deoxycytidylate deaminase [117756] (1 species)
  7. 594434Species Bacteriophage T4 [TaxId:10665] [117757] (1 PDB entry)
  8. 594435Domain d1vq2a_: 1vq2 A: [114004]
    complexed with ddn, zn; mutant

Details for d1vq2a_

PDB Entry: 1vq2 (more details), 2.2 Å

PDB Description: crystal structure of t4-bacteriophage deoxycytidylate deaminase, mutant r115e

SCOP Domain Sequences for d1vq2a_:

Sequence, based on SEQRES records: (download)

>d1vq2a_ c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage T4}
mkastvlqiaylvsqeskccswkvgaviekngriistgyngspaggvnccdyaaeqgwll
nkpkhaiiqghkpecvsfgstdrfvlakehrsahsewsskneihaelnailfaaengssi
egatmyvtlspcpdcakaiaqsgikklvycetydknkpgwddilrnagievfnvpkknln
klnweninefcge

Sequence, based on observed residues (ATOM records): (download)

>d1vq2a_ c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage T4}
mkastvlqiaylvsqeskccswkvgaviekngriistgyngspaggvnccdyaaeqgwll
nkrfvlakehrsahsewsskneihaelnailfaaengssiegatmyvtlspcpdcakaia
qsgikklvycetydknkpgwddilrnagievfnvpkknlnklnweninefcge

SCOP Domain Coordinates for d1vq2a_:

Click to download the PDB-style file with coordinates for d1vq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vq2a_: