SCOPe 2.06: Domain d1vq0b2: 1vq0 B:231-287

Lineage for d1vq0b2 (1vq0 B:231-287)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.81: HSP33 redox switch-like [118351] (1 superfamily)
   alpha+beta zinc-binding domain; alpha(2)-beta(2)-alpha

4. Superfamily g.81.1: HSP33 redox switch-like [118352] (1 family)

5. Family g.81.1.1: HSP33 redox switch-like [118353] (1 protein)

6. Protein HSP33, C-terminal domain [118354] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [118357] (1 PDB entry)
   Uniprot Q9X1B4

8. Domain d1vq0b2: 1vq0 B:231-287 [114003]
   Other proteins in same PDB: d1vq0a1, d1vq0a3, d1vq0b1, d1vq0b3
   Structural genomics target
   complexed with cl, edo, unl, zn

Details for d1vq0b2

PDB Entry: 1vq0, 2.2 Å

PDB Description: Crystal structure of 33 kDa chaperonin (Heat shock protein 33 homolog) (HSP33) (TM1394) from Thermotoga maritima at 2.20 A resolution

PDB Compounds: (B:) 33 kda chaperonin

SCOPe Domain Sequences for d1vq0b2:

Sequence; same for both SEQRES and ATOM records:

>d1vq0b2 g.81.1.1 (B:231-287) HSP33, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
cdcnrekaknallvldkkeledmrkegkgevvckwcntryvfseeeleellkfkvdd

Timeline for d1vq0b2:

• d1vq0b2 first appeared in SCOP 1.71
  
• d1vq0b2 appears in SCOPe 2.05
  
• d1vq0b2 appears in SCOPe 2.07
  
• d1vq0b2 appears in the current release, SCOPe 2.08