Lineage for d1vpzb_ (1vpz B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814721Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 1814722Superfamily b.151.1: CsrA-like [117130] (1 family) (S)
  5. 1814723Family b.151.1.1: CsrA-like [117131] (2 proteins)
    Pfam PF02599
  6. 1814724Protein Carbon storage regulator homolog, CsrA [117132] (2 species)
  7. 1814728Species Pseudomonas aeruginosa [TaxId:287] [117133] (1 PDB entry)
    Uniprot O69078
  8. 1814730Domain d1vpzb_: 1vpz B: [113999]
    Structural genomics target

Details for d1vpzb_

PDB Entry: 1vpz (more details), 2.05 Å

PDB Description: crystal structure of a putative carbon storage regulator protein (csra, pa0905) from pseudomonas aeruginosa at 2.05 a resolution
PDB Compounds: (B:) carbon storage regulator homolog

SCOPe Domain Sequences for d1vpzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpzb_ b.151.1.1 (B:) Carbon storage regulator homolog, CsrA {Pseudomonas aeruginosa [TaxId: 287]}
hhhmliltrrvgetlmvgddvtvtvlgvkgnqvrigvnapkevavhreeiyqriqk

SCOPe Domain Coordinates for d1vpzb_:

Click to download the PDB-style file with coordinates for d1vpzb_.
(The format of our PDB-style files is described here.)

Timeline for d1vpzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vpza_