Lineage for d1vpya_ (1vpy A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685961Superfamily c.1.32: TM1631-like [117396] (1 family) (S)
  5. 685962Family c.1.32.1: TM1631-like [117397] (2 proteins)
    Pfam PF01904; DUF72
  6. 685963Protein Hypothetical protein EF0366 [117400] (1 species)
  7. 685964Species Enterococcus faecalis [TaxId:1351] [117401] (1 PDB entry)
  8. 685965Domain d1vpya_: 1vpy A: [113997]
    Structural genomics target
    complexed with unl, zn

Details for d1vpya_

PDB Entry: 1vpy (more details), 2.52 Å

PDB Description: crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution
PDB Compounds: (A:) PROTEIN (hypothetical protein EF0366)

SCOP Domain Sequences for d1vpya_:

Sequence, based on SEQRES records: (download)

>d1vpya_ c.1.32.1 (A:) Hypothetical protein EF0366 {Enterococcus faecalis [TaxId: 1351]}
hhhhmirlgltsfsehdyltgkkrstlyeyashlplvemdtayygippkervaewvkavp
enfrfvmkvysgiscqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgct
kenvaylqkirhwfkdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnp
vpfypyvtnpnlvlfrfhgrnaagwlandaewrkkrtlyhyntqeiadlseavlkmsqea
kevgvifnnnsggdaaenalqmqkvlnls

Sequence, based on observed residues (ATOM records): (download)

>d1vpya_ c.1.32.1 (A:) Hypothetical protein EF0366 {Enterococcus faecalis [TaxId: 1351]}
hhhhmirlgltsfsstlyeyashlplvemdtayygippkervaewvkavpenfrfvmkvy
sgiscqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenvaylqki
rhwfkdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfypyvtnp
nlvlfrfhgrnaagwkkrtlyhyntqeiadlseavlkmsqeakevgvifnnnsggdaaen
alqmqkvlnls

SCOP Domain Coordinates for d1vpya_:

Click to download the PDB-style file with coordinates for d1vpya_.
(The format of our PDB-style files is described here.)

Timeline for d1vpya_: