Lineage for d1vpya1 (1vpy A:1-265)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090198Superfamily c.1.32: TM1631-like [117396] (1 family) (S)
    automatically mapped to Pfam PF01904
  5. 2090199Family c.1.32.1: TM1631-like [117397] (3 protein domains)
    Pfam PF01904; DUF72
  6. 2090200Protein Hypothetical protein EF0366 [117400] (1 species)
  7. 2090201Species Enterococcus faecalis [TaxId:1351] [117401] (1 PDB entry)
    Uniprot Q838R9 1-265
  8. 2090202Domain d1vpya1: 1vpy A:1-265 [113997]
    Other proteins in same PDB: d1vpya2
    Structural genomics target
    complexed with unl, zn

Details for d1vpya1

PDB Entry: 1vpy (more details), 2.52 Å

PDB Description: crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution
PDB Compounds: (A:) PROTEIN (hypothetical protein EF0366)

SCOPe Domain Sequences for d1vpya1:

Sequence, based on SEQRES records: (download)

>d1vpya1 c.1.32.1 (A:1-265) Hypothetical protein EF0366 {Enterococcus faecalis [TaxId: 1351]}
mirlgltsfsehdyltgkkrstlyeyashlplvemdtayygippkervaewvkavpenfr
fvmkvysgiscqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenv
aylqkirhwfkdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfy
pyvtnpnlvlfrfhgrnaagwlandaewrkkrtlyhyntqeiadlseavlkmsqeakevg
vifnnnsggdaaenalqmqkvlnls

Sequence, based on observed residues (ATOM records): (download)

>d1vpya1 c.1.32.1 (A:1-265) Hypothetical protein EF0366 {Enterococcus faecalis [TaxId: 1351]}
mirlgltsfsstlyeyashlplvemdtayygippkervaewvkavpenfrfvmkvysgis
cqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenvaylqkirhwf
kdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfypyvtnpnlvl
frfhgrnaagwkkrtlyhyntqeiadlseavlkmsqeakevgvifnnnsggdaaenalqm
qkvlnls

SCOPe Domain Coordinates for d1vpya1:

Click to download the PDB-style file with coordinates for d1vpya1.
(The format of our PDB-style files is described here.)

Timeline for d1vpya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpya2