Lineage for d1vpxs_ (1vpx S:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572456Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 572507Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (2 species)
    forms helix-swapped pentamers
  7. 572519Species Thermotoga maritima [TaxId:243274] [117379] (1 PDB entry)
  8. 572538Domain d1vpxs_: 1vpx S: [113995]

Details for d1vpxs_

PDB Entry: 1vpx (more details), 2.4 Å

PDB Description: Crystal structure of Transaldolase (EC 2.2.1.2) (TM0295) from Thermotoga maritima at 2.40 A resolution

SCOP Domain Sequences for d1vpxs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpxs_ c.1.10.1 (S:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima}
hmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevv
sldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaa
kagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgv
divtmpfavleklfkhpmtdlgier

SCOP Domain Coordinates for d1vpxs_:

Click to download the PDB-style file with coordinates for d1vpxs_.
(The format of our PDB-style files is described here.)

Timeline for d1vpxs_: