Lineage for d1vpxi1 (1vpx I:1-214)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2096985Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species)
    forms helix-swapped pentamers
  7. 2096997Species Thermotoga maritima [TaxId:2336] [117379] (1 PDB entry)
    Uniprot Q9WYD1
  8. 2097006Domain d1vpxi1: 1vpx I:1-214 [113985]
    Other proteins in same PDB: d1vpxa2, d1vpxb2, d1vpxc2, d1vpxd2, d1vpxe2, d1vpxf2, d1vpxg2, d1vpxh2, d1vpxi2, d1vpxj2, d1vpxk2, d1vpxl2, d1vpxm2, d1vpxn2, d1vpxo2, d1vpxp2, d1vpxq2, d1vpxr2, d1vpxs2, d1vpxt2
    Structural genomics target
    complexed with gol, so4

Details for d1vpxi1

PDB Entry: 1vpx (more details), 2.4 Å

PDB Description: Crystal structure of Transaldolase (EC 2.2.1.2) (TM0295) from Thermotoga maritima at 2.40 A resolution
PDB Compounds: (I:) PROTEIN (Transaldolase (EC 2.2.1.2))

SCOPe Domain Sequences for d1vpxi1:

Sequence, based on SEQRES records: (download)

>d1vpxi1 c.1.10.1 (I:1-214) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]}
mkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevvs
ldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaak
agatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvd
ivtmpfavleklfkhpmtdlgierfmedwkkyle

Sequence, based on observed residues (ATOM records): (download)

>d1vpxi1 c.1.10.1 (I:1-214) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]}
mkifldtanleeikkgvewgivdgvttnptlisfkqrvkeicdlvkgpvsaevvsldyeg
mvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakagaty
vspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivtmp
favleklfkhpmtdlgierfmedwkkyle

SCOPe Domain Coordinates for d1vpxi1:

Click to download the PDB-style file with coordinates for d1vpxi1.
(The format of our PDB-style files is described here.)

Timeline for d1vpxi1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpxi2