Lineage for d1vpxi_ (1vpx I:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 683990Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species)
    forms helix-swapped pentamers
  7. 684002Species Thermotoga maritima [TaxId:2336] [117379] (1 PDB entry)
  8. 684011Domain d1vpxi_: 1vpx I: [113985]

Details for d1vpxi_

PDB Entry: 1vpx (more details), 2.4 Å

PDB Description: Crystal structure of Transaldolase (EC 2.2.1.2) (TM0295) from Thermotoga maritima at 2.40 A resolution
PDB Compounds: (I:) PROTEIN (Transaldolase (EC 2.2.1.2))

SCOP Domain Sequences for d1vpxi_:

Sequence, based on SEQRES records: (download)

>d1vpxi_ c.1.10.1 (I:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]}
hhmkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaev
vsldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqaila
akagatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmg
vdivtmpfavleklfkhpmtdlgierfmedwkkyle

Sequence, based on observed residues (ATOM records): (download)

>d1vpxi_ c.1.10.1 (I:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]}
hhmkifldtanleeikkgvewgivdgvttnptlisfkqrvkeicdlvkgpvsaevvsldy
egmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaakaga
tyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvdivt
mpfavleklfkhpmtdlgierfmedwkkyle

SCOP Domain Coordinates for d1vpxi_:

Click to download the PDB-style file with coordinates for d1vpxi_.
(The format of our PDB-style files is described here.)

Timeline for d1vpxi_: