![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species) forms helix-swapped pentamers |
![]() | Species Thermotoga maritima [TaxId:2336] [117379] (1 PDB entry) Uniprot Q9WYD1 |
![]() | Domain d1vpxe1: 1vpx E:1-215 [113981] Other proteins in same PDB: d1vpxa2, d1vpxb2, d1vpxc2, d1vpxd2, d1vpxe2, d1vpxf2, d1vpxg2, d1vpxh2, d1vpxi2, d1vpxj2, d1vpxk2, d1vpxl2, d1vpxm2, d1vpxn2, d1vpxo2, d1vpxp2, d1vpxq2, d1vpxr2, d1vpxs2, d1vpxt2 Structural genomics target complexed with gol, so4 |
PDB Entry: 1vpx (more details), 2.4 Å
SCOPe Domain Sequences for d1vpxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpxe1 c.1.10.1 (E:1-215) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} mkifldtanleeikkgvewgivdgvttnptliskegaefkqrvkeicdlvkgpvsaevvs ldyegmvrearelaqiseyvvikipmtpdgikavktlsaegiktnvtlvfspaqailaak agatyvspfvgrmddlsndgmrmlgeiveiynnygfeteiiaasirhpmhvveaalmgvd ivtmpfavleklfkhpmtdlgierfmedwkkylen
Timeline for d1vpxe1:
![]() Domains from other chains: (mouse over for more information) d1vpxa1, d1vpxa2, d1vpxb1, d1vpxb2, d1vpxc1, d1vpxc2, d1vpxd1, d1vpxd2, d1vpxf1, d1vpxf2, d1vpxg1, d1vpxg2, d1vpxh1, d1vpxh2, d1vpxi1, d1vpxi2, d1vpxj1, d1vpxj2, d1vpxk1, d1vpxk2, d1vpxl1, d1vpxl2, d1vpxm1, d1vpxm2, d1vpxn1, d1vpxn2, d1vpxo1, d1vpxo2, d1vpxp1, d1vpxp2, d1vpxq1, d1vpxq2, d1vpxr1, d1vpxr2, d1vpxs1, d1vpxs2, d1vpxt1, d1vpxt2 |