Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
Family c.119.1.1: DegV-like [82550] (2 proteins) Pfam PF02645, DUF194 |
Protein Hypothetical protein TM841 [82551] (1 species) reveals fatty acid binding function |
Species Thermotoga maritima [TaxId:2336] [82552] (2 PDB entries) Uniprot Q9X1H9 |
Domain d1vpvb_: 1vpv B: [113976] Structural genomics target complexed with plm, po4 |
PDB Entry: 1vpv (more details), 2.45 Å
SCOPe Domain Sequences for d1vpvb_:
Sequence, based on SEQRES records: (download)
>d1vpvb_ c.119.1.1 (B:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]} mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvskfq gfvgnllkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadne agvvellntlrksyevvdeiispmgkvitthvgpgtvgfgievlerk
>d1vpvb_ c.119.1.1 (B:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]} mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvllki rvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadneagvvellnt lrksyevvdeiispmgkvitthvgpgtvgfgievlerk
Timeline for d1vpvb_: