SCOPe 2.08: Domain d1vpva_: 1vpv A:

Lineage for d1vpva_ (1vpv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.1: DegV-like [82550] (2 proteins)
   Pfam PF02645, DUF194

6. Protein Hypothetical protein TM841 [82551] (1 species)
   reveals fatty acid binding function

7. Species Thermotoga maritima [TaxId:2336] [82552] (2 PDB entries)
   Uniprot Q9X1H9

8. Domain d1vpva_: 1vpv A: [113975]
   Structural genomics target
   complexed with plm, po4

Details for d1vpva_

PDB Entry: 1vpv, 2.45 Å

PDB Description: Crystal structure of a degv lipid binding protein (tm1468) from thermotoga maritima at 2.45 A resolution

PDB Compounds: (A:) UPF0230 protein TM1468

SCOPe Domain Sequences for d1vpva_:

Sequence, based on SEQRES records:

>d1vpva_ c.119.1.1 (A:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]}
mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv
pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll
asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvskfq
gfvgnllkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadne
agvvellntlrksyevvdeiispmgkvitthvgpgtvgfgievlerk

Sequence, based on observed residues (ATOM records):

>d1vpva_ c.119.1.1 (A:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]}
mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv
pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll
asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvfvgn
llkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadneagvve
llntlrksyevvdeiispmgkvitthvgpgtvgfgievlerk

Timeline for d1vpva_:

• d1vpva_ first appeared in SCOP 1.71
  
• d1vpva_ appears in SCOPe 2.07