Lineage for d1vpva_ (1vpv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150492Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2150493Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2150494Family c.119.1.1: DegV-like [82550] (2 protein domains)
    Pfam PF02645, DUF194
  6. 2150499Protein Hypothetical protein TM841 [82551] (1 species)
    reveals fatty acid binding function
  7. 2150500Species Thermotoga maritima [TaxId:2336] [82552] (2 PDB entries)
    Uniprot Q9X1H9
  8. 2150502Domain d1vpva_: 1vpv A: [113975]
    Structural genomics target
    complexed with plm, po4

Details for d1vpva_

PDB Entry: 1vpv (more details), 2.45 Å

PDB Description: Crystal structure of a degv lipid binding protein (tm1468) from thermotoga maritima at 2.45 A resolution
PDB Compounds: (A:) UPF0230 protein TM1468

SCOPe Domain Sequences for d1vpva_:

Sequence, based on SEQRES records: (download)

>d1vpva_ c.119.1.1 (A:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]}
mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv
pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll
asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvskfq
gfvgnllkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadne
agvvellntlrksyevvdeiispmgkvitthvgpgtvgfgievlerk

Sequence, based on observed residues (ATOM records): (download)

>d1vpva_ c.119.1.1 (A:) Hypothetical protein TM841 {Thermotoga maritima [TaxId: 2336]}
mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsv
pktsqpsvedfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtll
asgaiplparvaremlengatieevlkkldermknkdfkaifyvsnfdylvkggrvfvgn
llkirvclhiengelipyrkvrgdkkaiealieklredtpegsklrvigvhadneagvve
llntlrksyevvdeiispmgkvitthvgpgtvgfgievlerk

SCOPe Domain Coordinates for d1vpva_:

Click to download the PDB-style file with coordinates for d1vpva_.
(The format of our PDB-style files is described here.)

Timeline for d1vpva_: