SCOPe 2.08: Domain d1vpqa1: 1vpq A:1-259

Lineage for d1vpqa1 (1vpq A:1-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.32: TM1631-like [117396] (1 family)
   automatically mapped to Pfam PF01904

5. Family c.1.32.1: TM1631-like [117397] (3 proteins)
   Pfam PF01904; DUF72

6. Protein Hypothetical protein TM1631 [117398] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [117399] (1 PDB entry)
   Uniprot Q9X1W6

8. Domain d1vpqa1: 1vpq A:1-259 [113974]
   Other proteins in same PDB: d1vpqa2
   Structural genomics target
   complexed with so4

Details for d1vpqa1

PDB Entry: 1vpq, 2.2 Å

PDB Description: crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution

PDB Compounds: (A:) hypothetical protein TM1631

SCOPe Domain Sequences for d1vpqa1:

Sequence; same for both SEQRES and ATOM records:

>d1vpqa1 c.1.32.1 (A:1-259) Hypothetical protein TM1631 {Thermotoga maritima [TaxId: 2336]}
mvyvgtsgfsfedwkgvvypehlkpsqflkyywavlgfrivelnftyytqpswrsfvqml
rktppdfyftvktpgsvthvlwkegkdpkedmenftrqieplieeqrlkmtlaqfpfsfk
fsrknveyleklresypyelavefrhyswdreetyeflrnhgitfvvvdepklpglfpyr
pitttdyayfrfhgrnerwfeaegeerydylyseeelktlfedvvelsrrvketyvffnn
cykgqaainalqfkkmlee

Timeline for d1vpqa1:

• d1vpqa1 first appeared in SCOP 1.71, called d1vpqa_
  
• d1vpqa1 appears in SCOPe 2.07