Lineage for d1vpoh2 (1vpo H:119-221)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549547Domain d1vpoh2: 1vpo H:119-221 [113971]
    Other proteins in same PDB: d1vpoh1, d1vpol1, d1vpol2
    MQ P18527 P01863 # natural chimera; anti-testosterone antibody (Fab)
    complexed with tes

Details for d1vpoh2

PDB Entry: 1vpo (more details), 2.15 Å

PDB Description: crystal structure analysis of the anti-testosterone fab in complex with testosterone

SCOP Domain Sequences for d1vpoh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpoh2 b.1.1.2 (H:119-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

SCOP Domain Coordinates for d1vpoh2:

Click to download the PDB-style file with coordinates for d1vpoh2.
(The format of our PDB-style files is described here.)

Timeline for d1vpoh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpoh1