Lineage for d1vpma_ (1vpm A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601788Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 601789Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 601790Family d.38.1.1: 4HBT-like [54638] (5 proteins)
    Pfam 03061
  6. 601797Protein Acyl-CoA hydrolase BH0798 [117883] (1 species)
  7. 601798Species Bacillus halodurans [TaxId:86665] [117884] (1 PDB entry)
  8. 601799Domain d1vpma_: 1vpm A: [113967]

Details for d1vpma_

PDB Entry: 1vpm (more details), 1.66 Å

PDB Description: crystal structure of acyl-coa hydrolase (np_241664.1) from bacillus halodurans at 1.66 a resolution

SCOP Domain Sequences for d1vpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans}
iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
kpkpvpqvepqteeekrlyetaparkenrkkraal

SCOP Domain Coordinates for d1vpma_:

Click to download the PDB-style file with coordinates for d1vpma_.
(The format of our PDB-style files is described here.)

Timeline for d1vpma_: