Lineage for d1vpma_ (1vpm A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. Protein Acyl-CoA hydrolase BH0798 [117883] (1 species)
  7. Species Bacillus halodurans [TaxId:86665] [117884] (2 PDB entries)
    Uniprot Q9KEQ1
  8. Domain d1vpma_: 1vpm A: [113967]
    Other proteins in same PDB: d1vpmc2
    Structural genomics target
    complexed with coa, po4

Details for d1vpma_

PDB Entry: 1vpm (more details), 1.6600000000000001 Å

PDB Description: crystal structure of acyl-coa hydrolase (np_241664.1) from bacillus halodurans at 1.66 a resolution
PDB Compounds: (A:) acyl-CoA hydrolase

SCOPe Domain Sequences for d1vpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}
iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
kpkpvpqvepqteeekrlyetaparkenrkkraal

SCOPe Domain Coordinates for d1vpma_ are not available.

Timeline for d1vpma_:

Domains from other chains:
(mouse over for more information)
d1vpmb_, d1vpmc1, d1vpmc2