Lineage for d1vpka3 (1vpk A:244-366)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. Species Thermotoga maritima [TaxId:2336] [118108] (1 PDB entry)
    Uniprot Q9WYA0
  8. Domain d1vpka3: 1vpk A:244-366 [113965]
    Other proteins in same PDB: d1vpka4
    Structural genomics target

Details for d1vpka3

PDB Entry: 1vpk (more details), 2 Å

PDB Description: Crystal structure of DNA polymerase III, beta subunit (TM0262) from Thermotoga maritima at 2.00 A resolution
PDB Compounds: (A:) DNA polymerase III, beta subunit

SCOPe Domain Sequences for d1vpka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpka3 d.131.1.1 (A:244-366) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]}
krvipetfktkvvvsrkelreslkrvmviaskgsesvkfeieenvmrlvskspdygevvd
evevqkegedlviafnpkfiedvlkhieteeiemnfvdstspcqinpldisgylyivmpi
rla

SCOPe Domain Coordinates for d1vpka3 are not available.

Timeline for d1vpka3:

Domains from same chain:
(mouse over for more information)
d1vpka1, d1vpka2, d1vpka4