![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.273: YjbQ-like [111037] (1 superfamily) beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets |
![]() | Superfamily d.273.1: YjbQ-like [111038] (2 families) ![]() |
![]() | Family d.273.1.1: YjbQ-like [111039] (5 proteins) Pfam PF01894 |
![]() | Protein Hypothetical protein SSO2532 [118036] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [118037] (1 PDB entry) Uniprot Q97VS8 |
![]() | Domain d1vphf1: 1vph F:1-137 [113960] Other proteins in same PDB: d1vpha2, d1vphc2, d1vphd2, d1vphe2, d1vphf2 Structural genomics target complexed with cl, edo, k, po4 |
PDB Entry: 1vph (more details), 1.76 Å
SCOPe Domain Sequences for d1vphf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vphf1 d.273.1.1 (F:1-137) Hypothetical protein SSO2532 {Sulfolobus solfataricus [TaxId: 2287]} mkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivaneherglm ediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflve ldgprserhitveilge
Timeline for d1vphf1: