Lineage for d1vphe_ (1vph E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617115Fold d.273: YjbQ-like [111037] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets
  4. 617116Superfamily d.273.1: YjbQ-like [111038] (1 family) (S)
  5. 617117Family d.273.1.1: YjbQ-like [111039] (4 proteins)
    Pfam 01894
  6. 617129Protein Hypothetical protein SSO2532 [118036] (1 species)
  7. 617130Species Sulfolobus solfataricus [TaxId:2287] [118037] (1 PDB entry)
  8. 617135Domain d1vphe_: 1vph E: [113959]

Details for d1vphe_

PDB Entry: 1vph (more details), 1.76 Å

PDB Description: crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution

SCOP Domain Sequences for d1vphe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vphe_ d.273.1.1 (E:) Hypothetical protein SSO2532 {Sulfolobus solfataricus}
hmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivanehergl
mediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflv
eldgprserhitveilge

SCOP Domain Coordinates for d1vphe_:

Click to download the PDB-style file with coordinates for d1vphe_.
(The format of our PDB-style files is described here.)

Timeline for d1vphe_: