SCOPe 2.08: Domain d1vphe1: 1vph E:1-137

Lineage for d1vphe1 (1vph E:1-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.273: YjbQ-like [111037] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets

4. Superfamily d.273.1: YjbQ-like [111038] (2 families)

5. Family d.273.1.1: YjbQ-like [111039] (5 proteins)
   Pfam PF01894

6. Protein Hypothetical protein SSO2532 [118036] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [118037] (1 PDB entry)
   Uniprot Q97VS8

8. Domain d1vphe1: 1vph E:1-137 [113959]
   Other proteins in same PDB: d1vpha2, d1vphc2, d1vphd2, d1vphe2, d1vphf2
   Structural genomics target
   complexed with cl, edo, k, po4

Details for d1vphe1

PDB Entry: 1vph, 1.76 Å

PDB Description: crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution

PDB Compounds: (E:) hypothetical protein SSO2532

SCOPe Domain Sequences for d1vphe1:

Sequence; same for both SEQRES and ATOM records:

>d1vphe1 d.273.1.1 (E:1-137) Hypothetical protein SSO2532 {Sulfolobus solfataricus [TaxId: 2287]}
mkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivaneherglm
ediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflve
ldgprserhitveilge

Timeline for d1vphe1:

• d1vphe1 first appeared in SCOP 1.71, called d1vphe_
  
• d1vphe1 appears in SCOPe 2.07