Lineage for d1vphc1 (1vph C:1-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009385Fold d.273: YjbQ-like [111037] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets
  4. 3009386Superfamily d.273.1: YjbQ-like [111038] (2 families) (S)
  5. 3009387Family d.273.1.1: YjbQ-like [111039] (5 proteins)
    Pfam PF01894
  6. 3009399Protein Hypothetical protein SSO2532 [118036] (1 species)
  7. 3009400Species Sulfolobus solfataricus [TaxId:2287] [118037] (1 PDB entry)
    Uniprot Q97VS8
  8. 3009403Domain d1vphc1: 1vph C:1-137 [113957]
    Other proteins in same PDB: d1vpha2, d1vphc2, d1vphd2, d1vphe2, d1vphf2
    Structural genomics target
    complexed with cl, edo, k, po4

Details for d1vphc1

PDB Entry: 1vph (more details), 1.76 Å

PDB Description: crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution
PDB Compounds: (C:) hypothetical protein SSO2532

SCOPe Domain Sequences for d1vphc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vphc1 d.273.1.1 (C:1-137) Hypothetical protein SSO2532 {Sulfolobus solfataricus [TaxId: 2287]}
mkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivaneherglm
ediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflve
ldgprserhitveilge

SCOPe Domain Coordinates for d1vphc1:

Click to download the PDB-style file with coordinates for d1vphc1.
(The format of our PDB-style files is described here.)

Timeline for d1vphc1: