Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.273: YjbQ-like [111037] (1 superfamily) beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets |
Superfamily d.273.1: YjbQ-like [111038] (1 family) |
Family d.273.1.1: YjbQ-like [111039] (4 proteins) Pfam 01894 |
Protein Hypothetical protein SSO2532 [118036] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [118037] (1 PDB entry) |
Domain d1vpha_: 1vph A: [113955] |
PDB Entry: 1vph (more details), 1.76 Å
SCOP Domain Sequences for d1vpha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpha_ d.273.1.1 (A:) Hypothetical protein SSO2532 {Sulfolobus solfataricus} hmkvyfddiyvstarqfelvditdqveqiveksgikngiclifvahstaaivanehergl mediltkikeftepsrswkhnliddnahahlgatflgaervfpvregklvrgtwqniflv eldgprserhitveilge
Timeline for d1vpha_: