SCOPe 2.05: Domain d1vpaa_: 1vpa A:

Lineage for d1vpaa_ (1vpa A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [117699] (1 PDB entry)
   Uniprot Q9X1B3

8. Domain d1vpaa_: 1vpa A: [113948]
   Structural genomics target
   complexed with acy, ctp, mg

Details for d1vpaa_

PDB Entry: 1vpa, 2.67 Å

PDB Description: Crystal structure of 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TM1393) from Thermotoga maritima at 2.67 A resolution

PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1vpaa_:

Sequence; same for both SEQRES and ATOM records:

>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]}
hhmnvaillaagkgermsenvpkqfleiegrmlfeyplstflkseaidgvvivtrrewfe
vvekrvfhekvlgiveggdtrsqsvrsaleflekfspsyvlvhdsarpflrkkhvsevlr
raretgaatlalknsdalvrvendrieyiprkgvyriltpqafsyeilkkahenggewad
dtepvqklgvkialvegdplcfkvtfkedlelariiarewe

Timeline for d1vpaa_:

• d1vpaa_ first appeared in SCOP 1.71
  
• d1vpaa_ appears in SCOPe 2.04
  
• d1vpaa_ is called d1vpaa1 in SCOPe 2.06
  
• d1vpaa_ appears in the current release, SCOPe 2.08, called d1vpaa1